Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3653446..3654064 | Replicon | chromosome |
| Accession | NZ_CP117615 | ||
| Organism | Escherichia albertii strain BIA_25 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS046_RS17855 | Protein ID | WP_001280991.1 |
| Coordinates | 3653446..3653664 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS046_RS17860 | Protein ID | WP_000344798.1 |
| Coordinates | 3653690..3654064 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS046_RS17820 (3648735) | 3648735..3649307 | + | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
| PS046_RS17825 (3649337) | 3649337..3649648 | - | 312 | WP_172843666.1 | MGMT family protein | - |
| PS046_RS17835 (3650029) | 3650029..3650382 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS046_RS17840 (3650420) | 3650420..3651970 | - | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS046_RS17845 (3652134) | 3652134..3652604 | - | 471 | WP_000136188.1 | YlaC family protein | - |
| PS046_RS17850 (3652712) | 3652712..3653269 | - | 558 | WP_059221620.1 | maltose O-acetyltransferase | - |
| PS046_RS17855 (3653446) | 3653446..3653664 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS046_RS17860 (3653690) | 3653690..3654064 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS046_RS17865 (3654619) | 3654619..3657768 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS046_RS17870 (3657791) | 3657791..3658984 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271716 WP_001280991.1 NZ_CP117615:c3653664-3653446 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271716 WP_000344798.1 NZ_CP117615:c3654064-3653690 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|