Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2420700..2421304 | Replicon | chromosome |
| Accession | NZ_CP117615 | ||
| Organism | Escherichia albertii strain BIA_25 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A8H9B4D1 |
| Locus tag | PS046_RS11880 | Protein ID | WP_059222236.1 |
| Coordinates | 2420918..2421304 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS046_RS11875 | Protein ID | WP_001195490.1 |
| Coordinates | 2420700..2420921 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS046_RS11860 (2416950) | 2416950..2418401 | + | 1452 | WP_095573909.1 | tagaturonate reductase | - |
| PS046_RS11865 (2418606) | 2418606..2419520 | + | 915 | WP_024164792.1 | bestrophin family protein | - |
| PS046_RS11870 (2419524) | 2419524..2420282 | - | 759 | WP_273811832.1 | trans-aconitate 2-methyltransferase | - |
| PS046_RS11875 (2420700) | 2420700..2420921 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS046_RS11880 (2420918) | 2420918..2421304 | + | 387 | WP_059222236.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS046_RS11885 (2421487) | 2421487..2425686 | - | 4200 | WP_273811834.1 | ESPR-type extended signal peptide-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14475.47 Da Isoelectric Point: 8.0833
>T271710 WP_059222236.1 NZ_CP117615:2420918-2421304 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|