Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 950810..951461 | Replicon | chromosome |
Accession | NZ_CP117615 | ||
Organism | Escherichia albertii strain BIA_25 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS046_RS04630 | Protein ID | WP_000244763.1 |
Coordinates | 951057..951461 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS046_RS04625 | Protein ID | WP_000354046.1 |
Coordinates | 950810..951076 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS046_RS04600 (946521) | 946521..947954 | - | 1434 | WP_024164724.1 | 6-phospho-beta-glucosidase BglA | - |
PS046_RS04605 (947999) | 947999..948310 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PS046_RS04610 (948478) | 948478..949137 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS046_RS04615 (949578) | 949578..950558 | - | 981 | WP_059221136.1 | tRNA-modifying protein YgfZ | - |
PS046_RS04620 (950590) | 950590..950820 | + | 231 | WP_000181267.1 | hypothetical protein | - |
PS046_RS04625 (950810) | 950810..951076 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS046_RS04630 (951057) | 951057..951461 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS046_RS04635 (951500) | 951500..952021 | - | 522 | WP_059221135.1 | flavodoxin FldB | - |
PS046_RS04640 (952133) | 952133..953029 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PS046_RS04645 (953054) | 953054..953764 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS046_RS04650 (953770) | 953770..955503 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271704 WP_000244763.1 NZ_CP117615:951057-951461 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |