Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 706900..707734 | Replicon | chromosome |
| Accession | NZ_CP117615 | ||
| Organism | Escherichia albertii strain BIA_25 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PS046_RS03465 | Protein ID | WP_273812744.1 |
| Coordinates | 707357..707734 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | PS046_RS03460 | Protein ID | WP_001285585.1 |
| Coordinates | 706900..707268 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS046_RS03430 (702178) | 702178..702855 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| PS046_RS03435 (702916) | 702916..703401 | + | 486 | WP_273812741.1 | antirestriction protein | - |
| PS046_RS03440 (703416) | 703416..703892 | + | 477 | WP_001186192.1 | RadC family protein | - |
| PS046_RS03445 (703997) | 703997..704752 | - | 756 | WP_001282649.1 | IS21-like element ISSso4 family helper ATPase IstB | - |
| PS046_RS03450 (704769) | 704769..706304 | - | 1536 | WP_256878094.1 | IS21-like element ISSso4 family transposase | - |
| PS046_RS03455 (706605) | 706605..706826 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| PS046_RS03460 (706900) | 706900..707268 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PS046_RS03465 (707357) | 707357..707734 | + | 378 | WP_273812744.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PS046_RS03470 (707731) | 707731..708219 | + | 489 | WP_000761723.1 | DUF5983 family protein | - |
| PS046_RS03475 (708239) | 708239..708436 | + | 198 | WP_000772026.1 | DUF957 domain-containing protein | - |
| PS046_RS03480 (708521) | 708521..709366 | + | 846 | WP_001274556.1 | DUF4942 domain-containing protein | - |
| PS046_RS03490 (709667) | 709667..710173 | + | 507 | WP_000245810.1 | G/U mismatch-specific DNA glycosylase | - |
| PS046_RS03495 (710253) | 710253..712094 | - | 1842 | WP_000437385.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | rfaE | 660587..763005 | 102418 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14087.13 Da Isoelectric Point: 8.4952
>T271703 WP_273812744.1 NZ_CP117615:707357-707734 [Escherichia albertii]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTQFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKYQEAKR
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTQFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKYQEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT271703 WP_001285585.1 NZ_CP117615:706900-707268 [Escherichia albertii]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|