Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 314381..315181 | Replicon | chromosome |
Accession | NZ_CP117615 | ||
Organism | Escherichia albertii strain BIA_25 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | PS046_RS01465 | Protein ID | WP_095574314.1 |
Coordinates | 314654..315181 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | PS046_RS01460 | Protein ID | WP_001277106.1 |
Coordinates | 314381..314647 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS046_RS01440 (310038) | 310038..310706 | + | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
PS046_RS01445 (310699) | 310699..311757 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
PS046_RS01450 (312002) | 312002..312856 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
PS046_RS01455 (313128) | 313128..314231 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PS046_RS01460 (314381) | 314381..314647 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
PS046_RS01465 (314654) | 314654..315181 | + | 528 | WP_095574314.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
PS046_RS01470 (315178) | 315178..315561 | - | 384 | WP_095574313.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PS046_RS01475 (315985) | 315985..317094 | + | 1110 | WP_095574312.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PS046_RS01480 (317142) | 317142..318068 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PS046_RS01485 (318065) | 318065..319342 | + | 1278 | WP_273812638.1 | branched chain amino acid ABC transporter permease LivM | - |
PS046_RS01490 (319339) | 319339..320106 | + | 768 | WP_000082094.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19464.36 Da Isoelectric Point: 6.6263
>T271702 WP_095574314.1 NZ_CP117615:314654-315181 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRACILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRACILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|