Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 150070..150682 | Replicon | chromosome |
Accession | NZ_CP117615 | ||
Organism | Escherichia albertii strain BIA_25 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | PS046_RS00680 | Protein ID | WP_000833473.1 |
Coordinates | 150070..150255 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PS046_RS00685 | Protein ID | WP_095574350.1 |
Coordinates | 150272..150682 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS046_RS00665 (145534) | 145534..146829 | + | 1296 | WP_059268237.1 | Fic family protein | - |
PS046_RS00670 (146937) | 146937..148475 | + | 1539 | WP_002460288.1 | aldehyde dehydrogenase AldB | - |
PS046_RS00675 (148516) | 148516..149595 | - | 1080 | WP_172843676.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
PS046_RS00680 (150070) | 150070..150255 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PS046_RS00685 (150272) | 150272..150682 | + | 411 | WP_095574350.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PS046_RS00690 (150754) | 150754..152718 | - | 1965 | WP_095574349.1 | glycoside hydrolase family 127 protein | - |
PS046_RS00695 (152729) | 152729..154129 | - | 1401 | WP_095574348.1 | MFS transporter | - |
PS046_RS00700 (154355) | 154355..155170 | + | 816 | WP_095574347.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T271699 WP_000833473.1 NZ_CP117615:150070-150255 [Escherichia albertii]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15231.11 Da Isoelectric Point: 4.5486
>AT271699 WP_095574350.1 NZ_CP117615:150272-150682 [Escherichia albertii]
MFYPAYIHSDPDGSASGFFPDVSGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVSGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|