Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 68584..69131 Replicon plasmid pEA26_2
Accession NZ_CP117611
Organism Escherichia albertii strain BIA_26

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag PS038_RS23330 Protein ID WP_001384452.1
Coordinates 68853..69131 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag PS038_RS23325 Protein ID WP_273818329.1
Coordinates 68584..68853 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS038_RS23295 (64236) 64236..64796 + 561 WP_273818327.1 fertility inhibition protein FinO -
PS038_RS23300 (64933) 64933..65146 + 214 Protein_75 hypothetical protein -
- (65728) 65728..65789 - 62 NuclAT_1 - -
- (65728) 65728..65789 - 62 NuclAT_1 - -
- (65728) 65728..65789 - 62 NuclAT_1 - -
- (65728) 65728..65789 - 62 NuclAT_1 - -
PS038_RS23305 (65833) 65833..65982 + 150 WP_001312851.1 Hok/Gef family protein -
PS038_RS23310 (66266) 66266..66523 + 258 WP_000083845.1 replication regulatory protein RepA -
PS038_RS23315 (66744) 66744..66818 + 75 WP_273818366.1 RepA leader peptide Tap -
PS038_RS23320 (66811) 66811..67668 + 858 WP_273818328.1 incFII family plasmid replication initiator RepA -
PS038_RS23325 (68584) 68584..68853 + 270 WP_273818329.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PS038_RS23330 (68853) 68853..69131 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
PS038_RS23335 (69141) 69141..69620 - 480 Protein_82 ATP-binding protein -
PS038_RS23340 (69620) 69620..69994 - 375 Protein_83 IS21 family transposase -
PS038_RS23345 (70090) 70090..71709 + 1620 WP_273818010.1 ISL3-like element ISEc38 family transposase -
PS038_RS23350 (71771) 71771..72896 - 1126 Protein_85 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - vat / espK 1..107716 107716


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T271695 WP_001384452.1 NZ_CP117611:68853-69131 [Escherichia albertii]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10265.60 Da        Isoelectric Point: 6.7263

>AT271695 WP_273818329.1 NZ_CP117611:68584-68853 [Escherichia albertii]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFHDQVEAGRQQLERGDMLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure

References