Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 3945771..3946478 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A4T3Q6D2 |
| Locus tag | PS038_RS18845 | Protein ID | WP_001683515.1 |
| Coordinates | 3945771..3946112 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PS038_RS18850 | Protein ID | WP_059219072.1 |
| Coordinates | 3946143..3946478 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS18825 (3943304) | 3943304..3944101 | - | 798 | WP_059219074.1 | helix-turn-helix transcriptional regulator | - |
| PS038_RS18830 (3944219) | 3944219..3944494 | - | 276 | WP_000409332.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PS038_RS18835 (3944498) | 3944498..3944746 | - | 249 | WP_000535212.1 | ribbon-helix-helix domain-containing protein | - |
| PS038_RS18840 (3944823) | 3944823..3945656 | - | 834 | WP_059219073.1 | DUF4942 domain-containing protein | - |
| PS038_RS18845 (3945771) | 3945771..3946112 | - | 342 | WP_001683515.1 | TA system toxin CbtA family protein | Toxin |
| PS038_RS18850 (3946143) | 3946143..3946478 | - | 336 | WP_059219072.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS038_RS18855 (3946478) | 3946478..3946951 | - | 474 | WP_059219071.1 | DNA repair protein RadC | - |
| PS038_RS18860 (3946981) | 3946981..3947799 | - | 819 | WP_059219070.1 | DUF932 domain-containing protein | - |
| PS038_RS18865 (3948035) | 3948035..3948988 | - | 954 | WP_059219069.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13034.05 Da Isoelectric Point: 9.5454
>T271693 WP_001683515.1 NZ_CP117609:c3946112-3945771 [Escherichia albertii]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCHNTTAR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCHNTTAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|