Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3309198..3309816 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS038_RS15855 | Protein ID | WP_001280991.1 |
| Coordinates | 3309598..3309816 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS038_RS15850 | Protein ID | WP_000344798.1 |
| Coordinates | 3309198..3309572 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS15840 (3304278) | 3304278..3305471 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS038_RS15845 (3305494) | 3305494..3308643 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS038_RS15850 (3309198) | 3309198..3309572 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS038_RS15855 (3309598) | 3309598..3309816 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS038_RS15860 (3309993) | 3309993..3310550 | + | 558 | WP_000093562.1 | maltose O-acetyltransferase | - |
| PS038_RS15865 (3310658) | 3310658..3311128 | + | 471 | WP_059218730.1 | YlaC family protein | - |
| PS038_RS15870 (3311292) | 3311292..3312842 | + | 1551 | WP_059218786.1 | EAL domain-containing protein | - |
| PS038_RS15875 (3312880) | 3312880..3313233 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS038_RS15885 (3313614) | 3313614..3313925 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS038_RS15890 (3313955) | 3313955..3314527 | - | 573 | WP_059216668.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271685 WP_001280991.1 NZ_CP117609:3309598-3309816 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271685 WP_000344798.1 NZ_CP117609:3309198-3309572 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|