Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2292437..2293041 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B1EM00 |
| Locus tag | PS038_RS11005 | Protein ID | WP_000638401.1 |
| Coordinates | 2292655..2293041 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS038_RS11000 | Protein ID | WP_001195490.1 |
| Coordinates | 2292437..2292658 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS10985 (2288906) | 2288906..2289031 | - | 126 | Protein_2149 | trans-aconitate 2-methyltransferase | - |
| PS038_RS10990 (2289352) | 2289352..2290704 | - | 1353 | WP_000347609.1 | SIR2 family protein | - |
| PS038_RS10995 (2290919) | 2290919..2292097 | - | 1179 | Protein_2151 | helix-turn-helix domain-containing protein | - |
| PS038_RS11000 (2292437) | 2292437..2292658 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS038_RS11005 (2292655) | 2292655..2293041 | + | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS038_RS11010 (2293121) | 2293121..2294008 | - | 888 | Protein_2154 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| PS038_RS11015 (2294100) | 2294100..2295719 | + | 1620 | WP_273818010.1 | ISL3-like element ISEc38 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2287587..2295719 | 8132 | |
| - | inside | IScluster/Tn | - | - | 2287587..2295719 | 8132 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T271683 WP_000638401.1 NZ_CP117609:2292655-2293041 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T5VDW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6PD20 |