Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1163562..1164229 | Replicon | chromosome |
Accession | NZ_CP117609 | ||
Organism | Escherichia albertii strain BIA_26 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | PS038_RS05585 | Protein ID | WP_059219247.1 |
Coordinates | 1163562..1163891 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | PS038_RS05590 | Protein ID | WP_059219248.1 |
Coordinates | 1163912..1164229 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS038_RS05560 (1159633) | 1159633..1159767 | + | 135 | WP_265349177.1 | hypothetical protein | - |
PS038_RS05565 (1160286) | 1160286..1160867 | + | 582 | WP_000062487.1 | hypothetical protein | - |
PS038_RS05570 (1160974) | 1160974..1161309 | - | 336 | Protein_1089 | IS200/IS605 family transposase | - |
PS038_RS05575 (1161829) | 1161829..1162509 | + | 681 | WP_059219246.1 | site-specific DNA-methyltransferase | - |
PS038_RS05580 (1162804) | 1162804..1163154 | - | 351 | Protein_1091 | integrase arm-type DNA-binding domain-containing protein | - |
PS038_RS05585 (1163562) | 1163562..1163891 | - | 330 | WP_059219247.1 | TA system toxin CbtA family protein | Toxin |
PS038_RS05590 (1163912) | 1163912..1164229 | - | 318 | WP_059219248.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PS038_RS05595 (1164247) | 1164247..1164468 | - | 222 | WP_059219249.1 | DUF987 domain-containing protein | - |
PS038_RS05600 (1164477) | 1164477..1164953 | - | 477 | WP_059219250.1 | RadC family protein | - |
PS038_RS05605 (1164969) | 1164969..1165358 | - | 390 | Protein_1096 | antirestriction protein | - |
PS038_RS05610 (1166738) | 1166738..1167031 | + | 294 | WP_059219254.1 | hypothetical protein | - |
PS038_RS05615 (1167324) | 1167324..1167842 | + | 519 | WP_059219255.1 | hypothetical protein | - |
PS038_RS05620 (1168002) | 1168002..1168987 | + | 986 | Protein_1099 | IS3-like element IS911 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1161829..1176591 | 14762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12301.22 Da Isoelectric Point: 9.9589
>T271678 WP_059219247.1 NZ_CP117609:c1163891-1163562 [Escherichia albertii]
MKPQPATTSRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSTETTIREHIDAGISLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
MKPQPATTSRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSTETTIREHIDAGISLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|