Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 64144..64919 Replicon plasmid pEA29_1
Accession NZ_CP117607
Organism Escherichia albertii strain BIA_29

Toxin (Protein)


Gene name tacT Uniprot ID A0A8D9PPA8
Locus tag PS031_RS23015 Protein ID WP_000405244.1
Coordinates 64144..64626 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag PS031_RS23020 Protein ID WP_001346256.1
Coordinates 64617..64919 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS031_RS22965 (59261) 59261..59482 - 222 Protein_52 transcriptional regulator -
PS031_RS22970 (60101) 60101..60343 - 243 Protein_53 type II toxin-antitoxin system RelE/ParE family toxin -
PS031_RS22975 (60375) 60375..60703 - 329 Protein_54 Tn3 family transposase -
PS031_RS22980 (60704) 60704..60915 - 212 Protein_55 3'-5' exonuclease -
PS031_RS22985 (60961) 60961..61238 - 278 Protein_56 type II toxin-antitoxin system toxin YacB -
PS031_RS22990 (61238) 61238..61507 - 270 WP_262930971.1 type II toxin-antitoxin system antitoxin YacA -
PS031_RS22995 (62420) 62420..63277 - 858 WP_122992027.1 incFII family plasmid replication initiator RepA -
PS031_RS23000 (63270) 63270..63317 - 48 WP_072248554.1 hypothetical protein -
PS031_RS23005 (63308) 63308..63541 + 234 WP_225856183.1 replication protein RepA -
PS031_RS23010 (63577) 63577..63834 - 258 WP_000083826.1 replication regulatory protein RepA -
PS031_RS23015 (64144) 64144..64626 - 483 WP_000405244.1 GNAT family N-acetyltransferase Toxin
PS031_RS23020 (64617) 64617..64919 - 303 WP_001346256.1 DUF1778 domain-containing protein Antitoxin
PS031_RS23025 (65240) 65240..65389 - 150 WP_001336447.1 Hok/Gef family protein -
- (65433) 65433..65494 + 62 NuclAT_1 - -
- (65433) 65433..65494 + 62 NuclAT_1 - -
- (65433) 65433..65494 + 62 NuclAT_1 - -
- (65433) 65433..65494 + 62 NuclAT_1 - -
PS031_RS23030 (65669) 65669..66049 - 381 Protein_65 DUF2726 domain-containing protein -
PS031_RS23035 (66240) 66240..66452 - 213 WP_273773806.1 hypothetical protein -
PS031_RS23040 (66588) 66588..67148 - 561 WP_074458664.1 fertility inhibition protein FinO -
PS031_RS23045 (67203) 67203..67949 - 747 WP_262930969.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - vat / papD / papC / faeI / faeH / faeF / faeE / faeD / faeC 1..116006 116006


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(30-149)

Antitoxin

Vibrio phage ICP1, Orf50

(15-99)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17659.41 Da        Isoelectric Point: 7.1036

>T271666 WP_000405244.1 NZ_CP117607:c64626-64144 [Escherichia albertii]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLHGRAMKNQMLNASRTFVICLEGTLRVVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11602.19 Da        Isoelectric Point: 4.4569

>AT271666 WP_001346256.1 NZ_CP117607:c64919-64617 [Escherichia albertii]
MEVVMPTTASIRKTPRENQINIRATDEERAVIDYAASLVNKNRTDFIIELAYQEAKNIILDQRLFVLDDECYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References