Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2783187..2783838 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS031_RS13615 | Protein ID | WP_000244763.1 |
| Coordinates | 2783187..2783591 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | PS031_RS13620 | Protein ID | WP_059224144.1 |
| Coordinates | 2783572..2783838 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS13595 (2779150) | 2779150..2780883 | - | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PS031_RS13600 (2780889) | 2780889..2781599 | - | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS031_RS13605 (2781624) | 2781624..2782520 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PS031_RS13610 (2782632) | 2782632..2783153 | + | 522 | WP_059221135.1 | flavodoxin FldB | - |
| PS031_RS13615 (2783187) | 2783187..2783591 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS031_RS13620 (2783572) | 2783572..2783838 | - | 267 | WP_059224144.1 | FAD assembly factor SdhE | Antitoxin |
| PS031_RS13625 (2783828) | 2783828..2784058 | - | 231 | WP_059224142.1 | hypothetical protein | - |
| PS031_RS13630 (2784090) | 2784090..2785070 | + | 981 | WP_059224140.1 | tRNA-modifying protein YgfZ | - |
| PS031_RS13635 (2785511) | 2785511..2786170 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS031_RS13640 (2786338) | 2786338..2786649 | - | 312 | WP_098401332.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS031_RS13645 (2786694) | 2786694..2788127 | + | 1434 | WP_024164724.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271655 WP_000244763.1 NZ_CP117606:c2783591-2783187 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|