Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 260876..261494 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS031_RS01255 | Protein ID | WP_001280991.1 |
| Coordinates | 260876..261094 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS031_RS01260 | Protein ID | WP_000344798.1 |
| Coordinates | 261120..261494 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS01220 (256165) | 256165..256737 | + | 573 | WP_059216668.1 | YbaY family lipoprotein | - |
| PS031_RS01225 (256767) | 256767..257078 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| PS031_RS01235 (257459) | 257459..257812 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS031_RS01240 (257850) | 257850..259400 | - | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS031_RS01245 (259564) | 259564..260034 | - | 471 | WP_000136188.1 | YlaC family protein | - |
| PS031_RS01250 (260142) | 260142..260699 | - | 558 | WP_204628716.1 | maltose O-acetyltransferase | - |
| PS031_RS01255 (260876) | 260876..261094 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS031_RS01260 (261120) | 261120..261494 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS031_RS01265 (262049) | 262049..265198 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS031_RS01270 (265221) | 265221..266414 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271645 WP_001280991.1 NZ_CP117606:c261094-260876 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271645 WP_000344798.1 NZ_CP117606:c261494-261120 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|