Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 22586..23111 | Replicon | plasmid pEA32_3 |
Accession | NZ_CP117603 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | PS047_RS25240 | Protein ID | WP_001159871.1 |
Coordinates | 22806..23111 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | Q3ZU16 |
Locus tag | PS047_RS25235 | Protein ID | WP_000813639.1 |
Coordinates | 22586..22804 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS25220 (19902) | 19902..20484 | + | 583 | Protein_16 | ISL3 family transposase | - |
PS047_RS25225 (20583) | 20583..20783 | + | 201 | Protein_17 | transposase | - |
PS047_RS25235 (22586) | 22586..22804 | + | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PS047_RS25240 (22806) | 22806..23111 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PS047_RS25245 (23112) | 23112..23918 | + | 807 | WP_273823988.1 | site-specific integrase | - |
PS047_RS25250 (24098) | 24098..24742 | + | 645 | WP_001144035.1 | ParA family protein | - |
PS047_RS25255 (24829) | 24829..25152 | + | 324 | WP_273823990.1 | molecular chaperone GroEL | - |
PS047_RS25260 (25577) | 25577..26557 | + | 981 | WP_273823992.1 | plasmid segregation protein ParM | - |
PS047_RS25265 (26550) | 26550..26966 | + | 417 | WP_273823994.1 | plasmid partitioning/stability family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | vat | 1..81187 | 81187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T271643 WP_001159871.1 NZ_CP117603:22806-23111 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9DIR5 |