Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 6062..6663 Replicon plasmid pEA32_2
Accession NZ_CP117602
Organism Escherichia albertii strain BIA_32

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag PS047_RS24630 Protein ID WP_273823959.1
Coordinates 6283..6663 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PS047_RS24625 Protein ID WP_001190712.1
Coordinates 6062..6283 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS047_RS24575 (PS047_24575) 1145..1378 + 234 WP_064638623.1 hypothetical protein -
PS047_RS24580 (PS047_24580) 1557..1850 + 294 WP_000269004.1 hypothetical protein -
PS047_RS24585 (PS047_24585) 1857..2231 + 375 WP_000988656.1 hypothetical protein -
PS047_RS24590 (PS047_24590) 2213..2887 + 675 WP_273823954.1 hypothetical protein -
PS047_RS24595 (PS047_24595) 2933..3199 + 267 WP_265451203.1 hypothetical protein -
PS047_RS24600 (PS047_24600) 3282..3695 + 414 WP_265451205.1 hypothetical protein -
PS047_RS24605 (PS047_24605) 4444..4839 - 396 WP_265451206.1 hypothetical protein -
PS047_RS24610 (PS047_24610) 4880..5086 - 207 WP_119047766.1 hypothetical protein -
PS047_RS24615 (PS047_24615) 5269..5463 - 195 WP_273823956.1 hypothetical protein -
PS047_RS24620 (PS047_24620) 5540..5839 - 300 WP_273823958.1 DNA-binding protein -
PS047_RS24625 (PS047_24625) 6062..6283 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PS047_RS24630 (PS047_24630) 6283..6663 + 381 WP_273823959.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PS047_RS24635 (PS047_24635) 6668..6847 + 180 WP_000113018.1 hypothetical protein -
PS047_RS24640 (PS047_24640) 6875..7918 + 1044 WP_273823961.1 DUF968 domain-containing protein -
PS047_RS24645 (PS047_24645) 8007..8474 + 468 WP_059257205.1 hypothetical protein -
PS047_RS24650 (PS047_24650) 8517..9728 + 1212 WP_124866782.1 RNA-guided endonuclease TnpB family protein -
PS047_RS24655 (PS047_24655) 9794..10987 + 1194 WP_273811299.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..101403 101403
- flank IS/Tn - - 8577..9728 1151


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13643.37 Da        Isoelectric Point: 5.1514

>T271642 WP_273823959.1 NZ_CP117602:6283-6663 [Escherichia albertii]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSVE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT271642 WP_001190712.1 NZ_CP117602:6062-6283 [Escherichia albertii]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References