Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 72992..73767 | Replicon | plasmid pEA32_1 |
| Accession | NZ_CP117601 | ||
| Organism | Escherichia albertii strain BIA_32 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8D9PPA8 |
| Locus tag | PS047_RS24250 | Protein ID | WP_000405244.1 |
| Coordinates | 72992..73474 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | PS047_RS24255 | Protein ID | WP_273823902.1 |
| Coordinates | 73465..73767 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS047_RS24220 (68215) | 68215..68964 | - | 750 | Protein_60 | IS256-like element IS1414 family transposase | - |
| PS047_RS24225 (69043) | 69043..69753 | + | 711 | WP_273823900.1 | sensor domain-containing diguanylate cyclase | - |
| PS047_RS24230 (70073) | 70073..70320 | - | 248 | Protein_62 | DUF6404 family protein | - |
| PS047_RS24235 (71269) | 71269..72126 | - | 858 | WP_273823901.1 | incFII family plasmid replication initiator RepA | - |
| PS047_RS24240 (72119) | 72119..72193 | - | 75 | WP_001367777.1 | RepA leader peptide Tap | - |
| PS047_RS24245 (72425) | 72425..72682 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PS047_RS24250 (72992) | 72992..73474 | - | 483 | WP_000405244.1 | GNAT family N-acetyltransferase | Toxin |
| PS047_RS24255 (73465) | 73465..73767 | - | 303 | WP_273823902.1 | DUF1778 domain-containing protein | Antitoxin |
| PS047_RS24260 (74005) | 74005..74154 | - | 150 | WP_074152653.1 | Hok/Gef family protein | - |
| PS047_RS24265 (74218) | 74218..75264 | + | 1047 | WP_273823903.1 | IS481 family transposase | - |
| - (75299) | 75299..75360 | + | 62 | NuclAT_0 | - | - |
| - (75299) | 75299..75360 | + | 62 | NuclAT_0 | - | - |
| - (75299) | 75299..75360 | + | 62 | NuclAT_0 | - | - |
| - (75299) | 75299..75360 | + | 62 | NuclAT_0 | - | - |
| PS047_RS24270 (75535) | 75535..75915 | - | 381 | Protein_70 | DUF2726 domain-containing protein | - |
| PS047_RS24275 (76109) | 76109..76321 | - | 213 | WP_059278122.1 | hypothetical protein | - |
| PS047_RS24280 (76457) | 76457..77017 | - | 561 | WP_273823904.1 | fertility inhibition protein FinO | - |
| PS047_RS24285 (77072) | 77072..77818 | - | 747 | WP_273823905.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 / gspE / gspD / gspC | 1..125136 | 125136 | |
| - | inside | IScluster/Tn | - | - | 63721..68964 | 5243 | |
| - | flank | IS/Tn | - | - | 74218..75264 | 1046 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17659.41 Da Isoelectric Point: 7.1036
>T271641 WP_000405244.1 NZ_CP117601:c73474-72992 [Escherichia albertii]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLHGRAMKNQMLNASRTFVICLEGTLRVVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV
MEINVTAPALLTDEHILQPFDCGNEVLSNWLHGRAMKNQMLNASRTFVICLEGTLRVVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|