Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 67568..68115 Replicon plasmid pEA32_1
Accession NZ_CP117601
Organism Escherichia albertii strain BIA_32

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag PS047_RS24210 Protein ID WP_001384452.1
Coordinates 67568..67846 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag PS047_RS24215 Protein ID WP_000079941.1
Coordinates 67846..68115 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS047_RS24190 (63721) 63721..64929 + 1209 WP_273823897.1 IS256-like element IS1414 family transposase -
PS047_RS24195 (64952) 64952..65230 - 279 WP_273823898.1 helix-turn-helix transcriptional regulator -
PS047_RS24200 (65230) 65230..65547 - 318 WP_273823936.1 type II toxin-antitoxin system RelE/ParE family toxin -
PS047_RS24205 (66021) 66021..67124 - 1104 WP_273823899.1 bifunctional L-1,2-propanediol dehydrogenase/glycerol dehydrogenase -
PS047_RS24210 (67568) 67568..67846 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
PS047_RS24215 (67846) 67846..68115 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PS047_RS24220 (68215) 68215..68964 - 750 Protein_60 IS256-like element IS1414 family transposase -
PS047_RS24225 (69043) 69043..69753 + 711 WP_273823900.1 sensor domain-containing diguanylate cyclase -
PS047_RS24230 (70073) 70073..70320 - 248 Protein_62 DUF6404 family protein -
PS047_RS24235 (71269) 71269..72126 - 858 WP_273823901.1 incFII family plasmid replication initiator RepA -
PS047_RS24240 (72119) 72119..72193 - 75 WP_001367777.1 RepA leader peptide Tap -
PS047_RS24245 (72425) 72425..72682 - 258 WP_000083845.1 replication regulatory protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - espL2 / gspE / gspD / gspC 1..125136 125136
- inside IScluster/Tn - - 63721..68964 5243


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T271640 WP_001384452.1 NZ_CP117601:c67846-67568 [Escherichia albertii]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT271640 WP_000079941.1 NZ_CP117601:c68115-67846 [Escherichia albertii]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References