Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4282235..4282853 | Replicon | chromosome |
Accession | NZ_CP117600 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PS047_RS21240 | Protein ID | WP_001280991.1 |
Coordinates | 4282235..4282453 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | PS047_RS21245 | Protein ID | WP_000344798.1 |
Coordinates | 4282479..4282853 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS21205 (4277524) | 4277524..4278096 | + | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
PS047_RS21210 (4278126) | 4278126..4278437 | - | 312 | WP_000409915.1 | MGMT family protein | - |
PS047_RS21220 (4278818) | 4278818..4279171 | + | 354 | WP_273823575.1 | DUF1428 family protein | - |
PS047_RS21225 (4279209) | 4279209..4280759 | - | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
PS047_RS21230 (4280923) | 4280923..4281393 | - | 471 | WP_000136188.1 | YlaC family protein | - |
PS047_RS21235 (4281501) | 4281501..4282058 | - | 558 | WP_059221620.1 | maltose O-acetyltransferase | - |
PS047_RS21240 (4282235) | 4282235..4282453 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PS047_RS21245 (4282479) | 4282479..4282853 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
PS047_RS21250 (4283408) | 4283408..4286557 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
PS047_RS21255 (4286580) | 4286580..4287773 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271639 WP_001280991.1 NZ_CP117600:c4282453-4282235 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271639 WP_000344798.1 NZ_CP117600:c4282853-4282479 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|