Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2772646..2773446 | Replicon | chromosome |
| Accession | NZ_CP117600 | ||
| Organism | Escherichia albertii strain BIA_32 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | PS047_RS14045 | Protein ID | WP_059220924.1 |
| Coordinates | 2772646..2773173 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | PS047_RS14050 | Protein ID | WP_001277106.1 |
| Coordinates | 2773180..2773446 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS047_RS14020 (2767721) | 2767721..2768488 | - | 768 | WP_059278385.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PS047_RS14025 (2768485) | 2768485..2769762 | - | 1278 | WP_273823441.1 | branched chain amino acid ABC transporter permease LivM | - |
| PS047_RS14030 (2769759) | 2769759..2770685 | - | 927 | WP_000003001.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PS047_RS14035 (2770733) | 2770733..2771842 | - | 1110 | WP_059220920.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PS047_RS14040 (2772266) | 2772266..2772649 | + | 384 | WP_059220922.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| PS047_RS14045 (2772646) | 2772646..2773173 | - | 528 | WP_059220924.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| PS047_RS14050 (2773180) | 2773180..2773446 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| PS047_RS14055 (2773596) | 2773596..2774699 | - | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| PS047_RS14060 (2774972) | 2774972..2775826 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| PS047_RS14065 (2776071) | 2776071..2777129 | - | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| PS047_RS14070 (2777122) | 2777122..2777790 | - | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19490.38 Da Isoelectric Point: 6.6303
>T271634 WP_059220924.1 NZ_CP117600:c2773173-2772646 [Escherichia albertii]
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|