Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2184689..2185340 | Replicon | chromosome |
Accession | NZ_CP117600 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS047_RS11135 | Protein ID | WP_000244763.1 |
Coordinates | 2184689..2185093 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS047_RS11140 | Protein ID | WP_000354046.1 |
Coordinates | 2185074..2185340 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS11115 (2180647) | 2180647..2182380 | - | 1734 | WP_059221131.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PS047_RS11120 (2182386) | 2182386..2183096 | - | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS047_RS11125 (2183121) | 2183121..2184017 | - | 897 | WP_059221133.1 | site-specific tyrosine recombinase XerD | - |
PS047_RS11130 (2184129) | 2184129..2184650 | + | 522 | WP_059221135.1 | flavodoxin FldB | - |
PS047_RS11135 (2184689) | 2184689..2185093 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS047_RS11140 (2185074) | 2185074..2185340 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS047_RS11145 (2185330) | 2185330..2185560 | - | 231 | WP_000181267.1 | hypothetical protein | - |
PS047_RS11150 (2185592) | 2185592..2186572 | + | 981 | WP_273823858.1 | tRNA-modifying protein YgfZ | - |
PS047_RS11155 (2186774) | 2186774..2187433 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS047_RS11160 (2187601) | 2187601..2187912 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PS047_RS11165 (2187957) | 2187957..2189390 | + | 1434 | WP_059221179.1 | 6-phospho-beta-glucosidase BglA | - |
PS047_RS11170 (2189437) | 2189437..2190330 | - | 894 | WP_059221140.1 | transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271633 WP_000244763.1 NZ_CP117600:c2185093-2184689 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |