Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 637464..638068 | Replicon | chromosome |
| Accession | NZ_CP117600 | ||
| Organism | Escherichia albertii strain BIA_32 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | PS047_RS03205 | Protein ID | WP_273823695.1 |
| Coordinates | 637464..637850 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS047_RS03210 | Protein ID | WP_001195490.1 |
| Coordinates | 637847..638068 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS047_RS03200 (635958) | 635958..637379 | + | 1422 | WP_273823694.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| PS047_RS03205 (637464) | 637464..637850 | - | 387 | WP_273823695.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS047_RS03210 (637847) | 637847..638068 | - | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS047_RS03215 (638432) | 638432..638512 | + | 81 | Protein_636 | trans-aconitate 2-methyltransferase | - |
| PS047_RS03220 (638516) | 638516..639430 | - | 915 | WP_024164792.1 | bestrophin family protein | - |
| PS047_RS03225 (639635) | 639635..641086 | - | 1452 | WP_059220135.1 | tagaturonate reductase | - |
| PS047_RS03230 (641333) | 641333..641996 | - | 664 | Protein_639 | GGDEF domain-containing protein | - |
| PS047_RS03235 (642132) | 642132..642494 | - | 363 | WP_001257078.1 | DUF4186 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14487.52 Da Isoelectric Point: 8.0833
>T271625 WP_273823695.1 NZ_CP117600:c637850-637464 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAAIYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAAIYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|