Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 56683..57208 | Replicon | plasmid pEA35_1 |
| Accession | NZ_CP117596 | ||
| Organism | Escherichia albertii strain BIA_35 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | PS050_RS23110 | Protein ID | WP_001159871.1 |
| Coordinates | 56903..57208 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | PS050_RS23105 | Protein ID | WP_000813630.1 |
| Coordinates | 56683..56901 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS050_RS23080 (51957) | 51957..52226 | - | 270 | WP_000343793.1 | hypothetical protein | - |
| PS050_RS23085 (52545) | 52545..54116 | + | 1572 | WP_256876213.1 | ATP-binding protein | - |
| PS050_RS23090 (54324) | 54324..55304 | - | 981 | WP_256876212.1 | hypothetical protein | - |
| PS050_RS23095 (55444) | 55444..55860 | - | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | - |
| PS050_RS23100 (55857) | 55857..56087 | - | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PS050_RS23105 (56683) | 56683..56901 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PS050_RS23110 (56903) | 56903..57208 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PS050_RS23115 (57209) | 57209..58015 | + | 807 | WP_000016970.1 | site-specific integrase | - |
| PS050_RS23120 (58737) | 58737..59492 | + | 756 | Protein_68 | replication initiation protein RepE | - |
| PS050_RS23125 (60080) | 60080..61246 | + | 1167 | WP_273819238.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | espL2 / vat | 1..88900 | 88900 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T271618 WP_001159871.1 NZ_CP117596:56903-57208 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |