Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 55444..56087 | Replicon | plasmid pEA35_1 |
Accession | NZ_CP117596 | ||
Organism | Escherichia albertii strain BIA_35 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | PS050_RS23095 | Protein ID | WP_256876211.1 |
Coordinates | 55444..55860 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | PS050_RS23100 | Protein ID | WP_256876210.1 |
Coordinates | 55857..56087 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS050_RS23070 (50495) | 50495..50836 | - | 342 | Protein_58 | protein RepA | - |
PS050_RS23075 (51373) | 51373..51969 | - | 597 | WP_256876215.1 | hypothetical protein | - |
PS050_RS23080 (51957) | 51957..52226 | - | 270 | WP_000343793.1 | hypothetical protein | - |
PS050_RS23085 (52545) | 52545..54116 | + | 1572 | WP_256876213.1 | ATP-binding protein | - |
PS050_RS23090 (54324) | 54324..55304 | - | 981 | WP_256876212.1 | hypothetical protein | - |
PS050_RS23095 (55444) | 55444..55860 | - | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PS050_RS23100 (55857) | 55857..56087 | - | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PS050_RS23105 (56683) | 56683..56901 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
PS050_RS23110 (56903) | 56903..57208 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
PS050_RS23115 (57209) | 57209..58015 | + | 807 | WP_000016970.1 | site-specific integrase | - |
PS050_RS23120 (58737) | 58737..59492 | + | 756 | Protein_68 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | espL2 / vat | 1..88900 | 88900 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T271617 WP_256876211.1 NZ_CP117596:c55860-55444 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|