Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 34728..35263 Replicon plasmid pEA35_1
Accession NZ_CP117596
Organism Escherichia albertii strain BIA_35

Toxin (Protein)


Gene name relE Uniprot ID A0A2H5C964
Locus tag PS050_RS22970 Protein ID WP_000222774.1
Coordinates 34976..35263 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag PS050_RS22965 Protein ID WP_001132900.1
Coordinates 34728..34979 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS050_RS22915 (29854) 29854..30414 + 561 WP_000139315.1 fertility inhibition protein FinO -
PS050_RS22920 (30550) 30550..30762 + 213 WP_001299730.1 ANR family transcriptional regulator -
PS050_RS22925 (31008) 31008..31082 + 75 Protein_29 endonuclease -
- (31338) 31338..31399 - 62 NuclAT_0 - -
- (31338) 31338..31399 - 62 NuclAT_0 - -
- (31338) 31338..31399 - 62 NuclAT_0 - -
- (31338) 31338..31399 - 62 NuclAT_0 - -
PS050_RS22930 (31443) 31443..31592 + 150 WP_001312851.1 Hok/Gef family protein -
PS050_RS22935 (31876) 31876..32133 + 258 WP_000083845.1 replication regulatory protein RepA -
PS050_RS22940 (32150) 32150..32401 - 252 WP_223195197.1 replication protein RepA -
PS050_RS22945 (32392) 32392..32439 + 48 WP_229471593.1 hypothetical protein -
PS050_RS22950 (32432) 32432..32914 + 483 WP_001273588.1 hypothetical protein -
PS050_RS22955 (32907) 32907..33764 + 858 WP_000774296.1 incFII family plasmid replication initiator RepA -
PS050_RS22960 (34464) 34464..34604 + 141 WP_162789007.1 hypothetical protein -
PS050_RS22965 (34728) 34728..34979 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PS050_RS22970 (34976) 34976..35263 + 288 WP_000222774.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS050_RS22975 (35433) 35433..35837 + 405 WP_000154256.1 DUF2251 domain-containing protein -
PS050_RS22980 (35838) 35838..36026 + 189 WP_128957842.1 hypothetical protein -
PS050_RS22985 (36033) 36033..36821 + 789 Protein_41 colicin-like pore-forming protein -
PS050_RS22990 (36843) 36843..37052 - 210 WP_273819261.1 colicin E1 family microcin immunity protein -
PS050_RS22995 (37175) 37175..38713 - 1539 WP_072643824.1 IS66 family transposase -
PS050_RS23000 (38763) 38763..39110 - 348 WP_000612591.1 IS66 family insertion sequence element accessory protein TnpB -
PS050_RS23005 (39107) 39107..39487 - 381 WP_029364370.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / vat 1..88900 88900


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11133.20 Da        Isoelectric Point: 10.5832

>T271616 WP_000222774.1 NZ_CP117596:34976-35263 [Escherichia albertii]
MTYTVKFRDDALKEWVKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT271616 WP_001132900.1 NZ_CP117596:34728-34979 [Escherichia albertii]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2H5C964

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References