Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4129975..4130570 | Replicon | chromosome |
| Accession | NZ_CP117595 | ||
| Organism | Escherichia albertii strain BIA_35 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | PS050_RS19910 | Protein ID | WP_059255551.1 |
| Coordinates | 4129975..4130325 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | PS050_RS19915 | Protein ID | WP_059255553.1 |
| Coordinates | 4130319..4130570 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS050_RS19890 (4125580) | 4125580..4126548 | + | 969 | WP_273818859.1 | PfkB family carbohydrate kinase | - |
| PS050_RS19895 (4126562) | 4126562..4127944 | + | 1383 | WP_137653529.1 | sugar porter family MFS transporter | - |
| PS050_RS19900 (4128030) | 4128030..4128530 | + | 501 | WP_059255546.1 | D-ribose pyranase | - |
| PS050_RS19905 (4128543) | 4128543..4129922 | + | 1380 | WP_137650500.1 | sugar porter family MFS transporter | - |
| PS050_RS19910 (4129975) | 4129975..4130325 | - | 351 | WP_059255551.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| PS050_RS19915 (4130319) | 4130319..4130570 | - | 252 | WP_059255553.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PS050_RS19920 (4130779) | 4130779..4131123 | - | 345 | WP_001219163.1 | gamma-glutamylcyclotransferase | - |
| PS050_RS19925 (4131126) | 4131126..4134905 | - | 3780 | WP_141109352.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12631.65 Da Isoelectric Point: 5.1420
>T271610 WP_059255551.1 NZ_CP117595:c4130325-4129975 [Escherichia albertii]
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|