Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3434219..3434837 | Replicon | chromosome |
| Accession | NZ_CP117595 | ||
| Organism | Escherichia albertii strain BIA_35 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS050_RS16625 | Protein ID | WP_001280991.1 |
| Coordinates | 3434619..3434837 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS050_RS16620 | Protein ID | WP_000344798.1 |
| Coordinates | 3434219..3434593 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS050_RS16610 (3429299) | 3429299..3430492 | + | 1194 | WP_273818734.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS050_RS16615 (3430515) | 3430515..3433664 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS050_RS16620 (3434219) | 3434219..3434593 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS050_RS16625 (3434619) | 3434619..3434837 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS050_RS16630 (3435014) | 3435014..3435571 | + | 558 | WP_000093562.1 | maltose O-acetyltransferase | - |
| PS050_RS16635 (3435679) | 3435679..3436149 | + | 471 | WP_000136189.1 | YlaC family protein | - |
| PS050_RS16640 (3436313) | 3436313..3437863 | + | 1551 | WP_273818735.1 | EAL domain-containing protein | - |
| PS050_RS16645 (3437901) | 3437901..3438254 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS050_RS16655 (3438635) | 3438635..3438946 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS050_RS16660 (3438976) | 3438976..3439548 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271604 WP_001280991.1 NZ_CP117595:3434619-3434837 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271604 WP_000344798.1 NZ_CP117595:3434219-3434593 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|