Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 493512..494347 Replicon chromosome
Accession NZ_CP117595
Organism Escherichia albertii strain BIA_35

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PS050_RS02455 Protein ID WP_089616158.1
Coordinates 493970..494347 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PS050_RS02450 Protein ID WP_089634143.1
Coordinates 493512..493880 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS050_RS02410 (488715) 488715..489095 - 381 WP_029364370.1 transposase -
PS050_RS02415 (489188) 489188..489712 - 525 Protein_472 IS21-like element IS100kyp family helper ATPase IstB -
PS050_RS02420 (489709) 489709..490731 - 1023 WP_273818787.1 IS21-like element IS100 family transposase -
PS050_RS02425 (490765) 490765..491472 + 708 Protein_474 DUF932 domain-containing protein -
PS050_RS02430 (491564) 491564..492049 + 486 WP_273819015.1 antirestriction protein -
PS050_RS02435 (492064) 492064..492540 + 477 WP_122987637.1 RadC family protein -
PS050_RS02440 (492609) 492609..492830 + 222 WP_089570377.1 DUF987 domain-containing protein -
PS050_RS02445 (492849) 492849..493496 + 648 WP_273819016.1 antitoxin of toxin-antitoxin stability system -
PS050_RS02450 (493512) 493512..493880 + 369 WP_089634143.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PS050_RS02455 (493970) 493970..494347 + 378 WP_089616158.1 TA system toxin CbtA family protein Toxin
PS050_RS02460 (494344) 494344..494832 + 489 WP_089634145.1 DUF5983 family protein -
PS050_RS02465 (494844) 494844..495041 + 198 WP_000839246.1 DUF957 domain-containing protein -
PS050_RS02470 (495126) 495126..495968 + 843 WP_024226410.1 DUF4942 domain-containing protein -
PS050_RS02475 (496343) 496343..496723 + 381 WP_029364370.1 transposase -
PS050_RS02480 (496720) 496720..497067 + 348 WP_000612591.1 IS66 family insertion sequence element accessory protein TnpB -
PS050_RS02485 (497117) 497117..498655 + 1539 WP_072643824.1 IS66 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 492064..507760 15696


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14276.39 Da        Isoelectric Point: 9.5914

>T271595 WP_089616158.1 NZ_CP117595:493970-494347 [Escherichia albertii]
MKTLSDTHVRKASRCPCPVTIWQTLLTRLLDQHYGLTLNDTPFADKRVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCAHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKYQEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13859.64 Da        Isoelectric Point: 6.4782

>AT271595 WP_089634143.1 NZ_CP117595:493512-493880 [Escherichia albertii]
VSDKLHETNYPEDHNDRIWWGLPCSVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References