Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 289547..290347 | Replicon | chromosome |
Accession | NZ_CP117595 | ||
Organism | Escherichia albertii strain BIA_35 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | B1EHN9 |
Locus tag | PS050_RS01355 | Protein ID | WP_000342453.1 |
Coordinates | 289820..290347 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | PS050_RS01350 | Protein ID | WP_001277106.1 |
Coordinates | 289547..289813 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS050_RS01325 (285268) | 285268..286122 | - | 855 | WP_000370583.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
PS050_RS01330 (286115) | 286115..286861 | - | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
PS050_RS01335 (286878) | 286878..287363 | - | 486 | WP_059256852.1 | PTS sugar transporter subunit IIB | - |
PS050_RS01340 (287370) | 287370..287771 | - | 402 | WP_001071334.1 | PTS sugar transporter subunit IIA | - |
PS050_RS01345 (288294) | 288294..289397 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PS050_RS01350 (289547) | 289547..289813 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
PS050_RS01355 (289820) | 289820..290347 | + | 528 | WP_000342453.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
PS050_RS01360 (290344) | 290344..290727 | - | 384 | WP_000778774.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PS050_RS01365 (291151) | 291151..292260 | + | 1110 | WP_000827693.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PS050_RS01370 (292308) | 292308..293234 | + | 927 | WP_160523110.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PS050_RS01375 (293231) | 293231..294508 | + | 1278 | WP_059225128.1 | branched chain amino acid ABC transporter permease LivM | - |
PS050_RS01380 (294505) | 294505..295272 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19676.58 Da Isoelectric Point: 6.9585
>T271594 WP_000342453.1 NZ_CP117595:289820-290347 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|