Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 69618..70143 | Replicon | plasmid pEA36_2 |
Accession | NZ_CP117592 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | PS051_RS24650 | Protein ID | WP_001159871.1 |
Coordinates | 69618..69923 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | Q3ZU16 |
Locus tag | PS051_RS24655 | Protein ID | WP_000813639.1 |
Coordinates | 69925..70143 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS24625 (65795) | 65795..66211 | - | 417 | WP_001278818.1 | plasmid partitioning/stability family protein | - |
PS051_RS24630 (66204) | 66204..67184 | - | 981 | WP_000688509.1 | plasmid segregation protein ParM | - |
PS051_RS24635 (67591) | 67591..67899 | - | 309 | WP_000030204.1 | molecular chaperone GroEL | - |
PS051_RS24640 (67986) | 67986..68630 | - | 645 | WP_001144036.1 | ParA family protein | - |
PS051_RS24645 (68809) | 68809..69617 | - | 809 | Protein_74 | site-specific integrase | - |
PS051_RS24650 (69618) | 69618..69923 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PS051_RS24655 (69925) | 69925..70143 | - | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PS051_RS24660 (70739) | 70739..70989 | + | 251 | Protein_77 | hypothetical protein | - |
PS051_RS24665 (70986) | 70986..71576 | + | 591 | WP_233929287.1 | hypothetical protein | - |
PS051_RS24670 (72104) | 72104..72550 | - | 447 | WP_096959008.1 | YhbP family protein | - |
PS051_RS24675 (72682) | 72682..73625 | - | 944 | Protein_80 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..89679 | 89679 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T271588 WP_001159871.1 NZ_CP117592:c69923-69618 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9DIR5 |