Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 61101..61726 | Replicon | plasmid pEA36_2 |
Accession | NZ_CP117592 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PS051_RS24590 | Protein ID | WP_000911317.1 |
Coordinates | 61328..61726 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PS051_RS24585 | Protein ID | WP_021541611.1 |
Coordinates | 61101..61328 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS24585 (61101) | 61101..61328 | + | 228 | WP_021541611.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PS051_RS24590 (61328) | 61328..61726 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PS051_RS24595 (61735) | 61735..62586 | - | 852 | Protein_64 | type IV secretion system DNA-binding domain-containing protein | - |
PS051_RS24600 (62581) | 62581..62703 | - | 123 | Protein_65 | hypothetical protein | - |
PS051_RS24605 (63279) | 63279..63416 | - | 138 | Protein_66 | hypothetical protein | - |
PS051_RS24610 (63837) | 63837..64085 | + | 249 | WP_032084478.1 | DinI-like family protein | - |
PS051_RS24615 (64133) | 64133..64519 | + | 387 | WP_001462441.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
PS051_RS24620 (64519) | 64519..65793 | + | 1275 | WP_233929288.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
PS051_RS24625 (65795) | 65795..66211 | - | 417 | WP_001278818.1 | plasmid partitioning/stability family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..89679 | 89679 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T271587 WP_000911317.1 NZ_CP117592:61328-61726 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|