Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 72272..72873 | Replicon | plasmid pEA36_1 |
Accession | NZ_CP117591 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | PS051_RS24095 | Protein ID | WP_001216034.1 |
Coordinates | 72272..72652 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | PS051_RS24100 | Protein ID | WP_001190712.1 |
Coordinates | 72652..72873 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS24065 (PS051_24065) | 67403..67633 | - | 231 | Protein_69 | ash family protein | - |
PS051_RS24070 (PS051_24070) | 67717..69201 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
PS051_RS24075 (PS051_24075) | 69201..70394 | - | 1194 | WP_119047760.1 | terminase | - |
PS051_RS24080 (PS051_24080) | 70476..70928 | - | 453 | WP_119047761.1 | Late promoter-activating protein | - |
PS051_RS24085 (PS051_24085) | 71017..72060 | - | 1044 | WP_273782055.1 | DUF968 domain-containing protein | - |
PS051_RS24090 (PS051_24090) | 72088..72267 | - | 180 | WP_001513661.1 | hypothetical protein | - |
PS051_RS24095 (PS051_24095) | 72272..72652 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PS051_RS24100 (PS051_24100) | 72652..72873 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PS051_RS24105 (PS051_24105) | 73056..74612 | + | 1557 | WP_273782056.1 | type I restriction-modification system subunit M | - |
PS051_RS24110 (PS051_24110) | 74609..75928 | + | 1320 | WP_273782057.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..103275 | 103275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T271582 WP_001216034.1 NZ_CP117591:c72652-72272 [Escherichia albertii]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |