Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3520489..3521107 | Replicon | chromosome |
Accession | NZ_CP117590 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PS051_RS17610 | Protein ID | WP_001280991.1 |
Coordinates | 3520889..3521107 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | PS051_RS17605 | Protein ID | WP_000344798.1 |
Coordinates | 3520489..3520863 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS17595 (3515569) | 3515569..3516762 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PS051_RS17600 (3516785) | 3516785..3519934 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
PS051_RS17605 (3520489) | 3520489..3520863 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
PS051_RS17610 (3520889) | 3520889..3521107 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PS051_RS17615 (3521284) | 3521284..3521841 | + | 558 | WP_059221620.1 | maltose O-acetyltransferase | - |
PS051_RS17620 (3521949) | 3521949..3522419 | + | 471 | WP_000136188.1 | YlaC family protein | - |
PS051_RS17625 (3522583) | 3522583..3524133 | + | 1551 | WP_273781230.1 | EAL domain-containing protein | - |
PS051_RS17630 (3524171) | 3524171..3524524 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
PS051_RS17640 (3524905) | 3524905..3525216 | + | 312 | WP_000409915.1 | MGMT family protein | - |
PS051_RS17645 (3525246) | 3525246..3525818 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271577 WP_001280991.1 NZ_CP117590:3520889-3521107 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271577 WP_000344798.1 NZ_CP117590:3520489-3520863 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|