Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 879270..879921 | Replicon | chromosome |
| Accession | NZ_CP117590 | ||
| Organism | Escherichia albertii strain BIA_36 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS051_RS04265 | Protein ID | WP_000244763.1 |
| Coordinates | 879517..879921 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS051_RS04260 | Protein ID | WP_000354046.1 |
| Coordinates | 879270..879536 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS051_RS04230 (874280) | 874280..875173 | + | 894 | WP_059221140.1 | transporter | - |
| PS051_RS04235 (875220) | 875220..876653 | - | 1434 | WP_273781680.1 | 6-phospho-beta-glucosidase BglA | - |
| PS051_RS04240 (876698) | 876698..877009 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS051_RS04245 (877177) | 877177..877836 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS051_RS04250 (878038) | 878038..879018 | - | 981 | WP_273781681.1 | tRNA-modifying protein YgfZ | - |
| PS051_RS04255 (879050) | 879050..879280 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| PS051_RS04260 (879270) | 879270..879536 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS051_RS04265 (879517) | 879517..879921 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS051_RS04270 (879955) | 879955..880476 | - | 522 | WP_059221135.1 | flavodoxin FldB | - |
| PS051_RS04275 (880588) | 880588..881484 | + | 897 | WP_273781682.1 | site-specific tyrosine recombinase XerD | - |
| PS051_RS04280 (881509) | 881509..882219 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS051_RS04285 (882225) | 882225..883958 | + | 1734 | WP_273781683.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271565 WP_000244763.1 NZ_CP117590:879517-879921 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |