Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 290947..291747 | Replicon | chromosome |
| Accession | NZ_CP117590 | ||
| Organism | Escherichia albertii strain BIA_36 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | PS051_RS01335 | Protein ID | WP_059220924.1 |
| Coordinates | 291220..291747 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | PS051_RS01330 | Protein ID | WP_001277106.1 |
| Coordinates | 290947..291213 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS051_RS01310 (286603) | 286603..287271 | + | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
| PS051_RS01315 (287264) | 287264..288322 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| PS051_RS01320 (288567) | 288567..289421 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| PS051_RS01325 (289694) | 289694..290797 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| PS051_RS01330 (290947) | 290947..291213 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| PS051_RS01335 (291220) | 291220..291747 | + | 528 | WP_059220924.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| PS051_RS01340 (291744) | 291744..292127 | - | 384 | WP_273781558.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| PS051_RS01345 (292551) | 292551..293660 | + | 1110 | WP_273781559.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PS051_RS01350 (293708) | 293708..294634 | + | 927 | WP_273781560.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PS051_RS01355 (294631) | 294631..295908 | + | 1278 | WP_273781561.1 | branched chain amino acid ABC transporter permease LivM | - |
| PS051_RS01360 (295905) | 295905..296672 | + | 768 | WP_273781562.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19490.38 Da Isoelectric Point: 6.6303
>T271564 WP_059220924.1 NZ_CP117590:291220-291747 [Escherichia albertii]
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|