Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 50305..50840 Replicon plasmid pEA40_2
Accession NZ_CP117588
Organism Escherichia albertii strain BIA_40

Toxin (Protein)


Gene name relE Uniprot ID T2HS21
Locus tag PS042_RS24565 Protein ID WP_000222775.1
Coordinates 50553..50840 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T2HSA2
Locus tag PS042_RS24560 Protein ID WP_001139207.1
Coordinates 50305..50556 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS042_RS24520 (PS042_24520) 45412..45630 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA -
PS042_RS24525 (PS042_24525) 45632..45937 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
PS042_RS24530 (PS042_24530) 45938..46746 + 809 Protein_46 site-specific integrase -
PS042_RS24535 (PS042_24535) 46926..47570 + 645 WP_001144036.1 ParA family protein -
PS042_RS24540 (PS042_24540) 47657..47965 + 309 WP_000030204.1 molecular chaperone GroEL -
PS042_RS24545 (PS042_24545) 48377..49357 + 981 WP_256875926.1 plasmid segregation protein ParM -
PS042_RS24550 (PS042_24550) 49350..49766 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
PS042_RS24555 (PS042_24555) 49768..50190 - 423 Protein_51 DUF4113 domain-containing protein -
PS042_RS24560 (PS042_24560) 50305..50556 + 252 WP_001139207.1 plasmid stabilization protein Antitoxin
PS042_RS24565 (PS042_24565) 50553..50840 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS042_RS24570 (PS042_24570) 50850..51221 + 372 WP_256875924.1 hypothetical protein -
PS042_RS24575 (PS042_24575) 52122..52708 + 587 Protein_55 serine acetyltransferase -
PS042_RS24580 (PS042_24580) 52988..53581 - 594 WP_001523457.1 ProQ/FINO family protein -
PS042_RS24585 (PS042_24585) 54585..55349 + 765 WP_256875923.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / faeH / faeI 1..79665 79665


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11142.17 Da        Isoelectric Point: 10.6261

>T271561 WP_000222775.1 NZ_CP117588:50553-50840 [Escherichia albertii]
MTYTVKFRDDALREWLKLDKSVQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSHVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9216.45 Da        Isoelectric Point: 4.0927

>AT271561 WP_001139207.1 NZ_CP117588:50305-50556 [Escherichia albertii]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDAMDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T2HS21

Antitoxin

Source ID Structure
AlphaFold DB A0A754EQ65

References