Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 45412..45937 Replicon plasmid pEA40_2
Accession NZ_CP117588
Organism Escherichia albertii strain BIA_40

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PS042_RS24525 Protein ID WP_001159871.1
Coordinates 45632..45937 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag PS042_RS24520 Protein ID WP_000813639.1
Coordinates 45412..45630 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS042_RS24485 (PS042_24485) 40976..42568 - 1593 WP_256878671.1 IS66 family transposase -
PS042_RS24490 (PS042_24490) 42599..42949 - 351 WP_000624718.1 IS66 family insertion sequence element accessory protein TnpB -
PS042_RS24495 (PS042_24495) 42946..43365 - 420 WP_065106474.1 transposase -
PS042_RS24500 (PS042_24500) 43452..43637 + 186 Protein_40 transposase -
PS042_RS24505 (PS042_24505) 43633..43902 - 270 Protein_41 tyrosine-type recombinase/integrase -
PS042_RS24510 (PS042_24510) 43962..44558 - 597 WP_059217960.1 hypothetical protein -
PS042_RS24515 (PS042_24515) 44546..44815 - 270 WP_000343793.1 hypothetical protein -
PS042_RS24520 (PS042_24520) 45412..45630 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PS042_RS24525 (PS042_24525) 45632..45937 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PS042_RS24530 (PS042_24530) 45938..46746 + 809 Protein_46 site-specific integrase -
PS042_RS24535 (PS042_24535) 46926..47570 + 645 WP_001144036.1 ParA family protein -
PS042_RS24540 (PS042_24540) 47657..47965 + 309 WP_000030204.1 molecular chaperone GroEL -
PS042_RS24545 (PS042_24545) 48377..49357 + 981 WP_256875926.1 plasmid segregation protein ParM -
PS042_RS24550 (PS042_24550) 49350..49766 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
PS042_RS24555 (PS042_24555) 49768..50190 - 423 Protein_51 DUF4113 domain-containing protein -
PS042_RS24560 (PS042_24560) 50305..50556 + 252 WP_001139207.1 plasmid stabilization protein -
PS042_RS24565 (PS042_24565) 50553..50840 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / faeH / faeI 1..79665 79665


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T271560 WP_001159871.1 NZ_CP117588:45632-45937 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT271560 WP_000813639.1 NZ_CP117588:45412-45630 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References