Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 31555..32156 | Replicon | plasmid pEA40_1 |
| Accession | NZ_CP117587 | ||
| Organism | Escherichia albertii strain BIA_40 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | PS042_RS23960 | Protein ID | WP_001216045.1 |
| Coordinates | 31776..32156 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | PS042_RS23955 | Protein ID | WP_001190712.1 |
| Coordinates | 31555..31776 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS042_RS23945 (PS042_23945) | 28590..29819 | - | 1230 | WP_256908116.1 | restriction endonuclease subunit S | - |
| PS042_RS23950 (PS042_23950) | 29816..31372 | - | 1557 | WP_137647606.1 | type I restriction-modification system subunit M | - |
| PS042_RS23955 (PS042_23955) | 31555..31776 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS042_RS23960 (PS042_23960) | 31776..32156 | + | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS042_RS23965 (PS042_23965) | 32161..32340 | + | 180 | WP_000113018.1 | hypothetical protein | - |
| PS042_RS23970 (PS042_23970) | 32368..33411 | + | 1044 | WP_256908115.1 | DUF968 domain-containing protein | - |
| PS042_RS23975 (PS042_23975) | 33500..33967 | + | 468 | WP_089589729.1 | Late promoter-activating protein | - |
| PS042_RS23980 (PS042_23980) | 34010..35221 | + | 1212 | WP_273777117.1 | transposase | - |
| PS042_RS23985 (PS042_23985) | 35287..36480 | + | 1194 | WP_256908157.1 | terminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..95160 | 95160 | |
| - | flank | IS/Tn | - | - | 34070..35221 | 1151 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T271559 WP_001216045.1 NZ_CP117587:31776-32156 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |