Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3597378..3597996 | Replicon | chromosome |
| Accession | NZ_CP117586 | ||
| Organism | Escherichia albertii strain BIA_40 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS042_RS17965 | Protein ID | WP_001280991.1 |
| Coordinates | 3597778..3597996 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS042_RS17960 | Protein ID | WP_000344798.1 |
| Coordinates | 3597378..3597752 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS042_RS17950 (3592458) | 3592458..3593651 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS042_RS17955 (3593674) | 3593674..3596823 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS042_RS17960 (3597378) | 3597378..3597752 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS042_RS17965 (3597778) | 3597778..3597996 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS042_RS17970 (3598173) | 3598173..3598730 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| PS042_RS17975 (3598837) | 3598837..3599307 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| PS042_RS17980 (3599471) | 3599471..3601021 | + | 1551 | WP_059234326.1 | EAL domain-containing protein | - |
| PS042_RS17985 (3601059) | 3601059..3601412 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS042_RS17995 (3601793) | 3601793..3602104 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS042_RS18000 (3602134) | 3602134..3602706 | - | 573 | WP_256875765.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271552 WP_001280991.1 NZ_CP117586:3597778-3597996 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271552 WP_000344798.1 NZ_CP117586:3597378-3597752 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|