Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 142848..143460 | Replicon | chromosome |
Accession | NZ_CP117586 | ||
Organism | Escherichia albertii strain BIA_40 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | PS042_RS00630 | Protein ID | WP_000833473.1 |
Coordinates | 142848..143033 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PS042_RS00635 | Protein ID | WP_059235556.1 |
Coordinates | 143050..143460 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS042_RS00615 (138312) | 138312..139607 | + | 1296 | WP_059235552.1 | Fic family protein | - |
PS042_RS00620 (139715) | 139715..141253 | + | 1539 | WP_002460288.1 | aldehyde dehydrogenase AldB | - |
PS042_RS00625 (141294) | 141294..142373 | - | 1080 | WP_025238097.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
PS042_RS00630 (142848) | 142848..143033 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PS042_RS00635 (143050) | 143050..143460 | + | 411 | WP_059235556.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PS042_RS00640 (143532) | 143532..145496 | - | 1965 | WP_256875795.1 | glycoside hydrolase family 127 protein | - |
PS042_RS00645 (145507) | 145507..146907 | - | 1401 | WP_025238099.1 | MFS transporter | - |
PS042_RS00650 (147133) | 147133..147948 | + | 816 | WP_059242247.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T271537 WP_000833473.1 NZ_CP117586:142848-143033 [Escherichia albertii]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15193.10 Da Isoelectric Point: 4.5486
>AT271537 WP_059235556.1 NZ_CP117586:143050-143460 [Escherichia albertii]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQVEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQVEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|