Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5415..5940 Replicon plasmid pEA41_1
Accession NZ_CP117584
Organism Escherichia albertii strain BIA_41

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PS045_RS22710 Protein ID WP_001159871.1
Coordinates 5635..5940 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag PS045_RS22705 Protein ID WP_000813639.1
Coordinates 5415..5633 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS045_RS22690 (PS045_22690) 2246..2656 - 411 WP_256878411.1 subtilase family AB5 toxin binding subunit -
PS045_RS22695 (PS045_22695) 2766..3491 - 726 WP_256878412.1 enterotoxin A family protein -
PS045_RS22700 (PS045_22700) 3814..4942 + 1129 Protein_3 IS3 family transposase -
PS045_RS22705 (PS045_22705) 5415..5633 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PS045_RS22710 (PS045_22710) 5635..5940 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PS045_RS22715 (PS045_22715) 5941..6749 + 809 Protein_6 site-specific integrase -
PS045_RS22720 (PS045_22720) 6929..7573 + 645 WP_001144036.1 ParA family protein -
PS045_RS22725 (PS045_22725) 7660..7968 + 309 WP_000030204.1 molecular chaperone GroEL -
PS045_RS22730 (PS045_22730) 8380..9360 + 981 WP_256878413.1 plasmid segregation protein ParM -
PS045_RS22735 (PS045_22735) 9353..9769 + 417 WP_273775112.1 plasmid partitioning/stability family protein -
PS045_RS22740 (PS045_22740) 9771..9980 - 210 Protein_11 DUF4113 domain-containing protein -
PS045_RS22745 (PS045_22745) 10077..10283 + 207 Protein_12 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / espL2 / iucA / iucB / iucC / iucD / iutA / vat 1..76945 76945


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T271536 WP_001159871.1 NZ_CP117584:5635-5940 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT271536 WP_000813639.1 NZ_CP117584:5415-5633 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References