Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2007880..2008531 | Replicon | chromosome |
| Accession | NZ_CP117583 | ||
| Organism | Escherichia albertii strain BIA_41 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS045_RS09760 | Protein ID | WP_000244763.1 |
| Coordinates | 2007880..2008284 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS045_RS09765 | Protein ID | WP_000354046.1 |
| Coordinates | 2008265..2008531 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS045_RS09740 (2003838) | 2003838..2005571 | - | 1734 | WP_059258720.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PS045_RS09745 (2005577) | 2005577..2006287 | - | 711 | WP_000748105.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS045_RS09750 (2006312) | 2006312..2007208 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PS045_RS09755 (2007320) | 2007320..2007841 | + | 522 | WP_125060507.1 | flavodoxin FldB | - |
| PS045_RS09760 (2007880) | 2007880..2008284 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS045_RS09765 (2008265) | 2008265..2008531 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS045_RS09770 (2008521) | 2008521..2008751 | - | 231 | WP_000181267.1 | hypothetical protein | - |
| PS045_RS09775 (2008783) | 2008783..2009763 | + | 981 | WP_256878858.1 | tRNA-modifying protein YgfZ | - |
| PS045_RS09780 (2010203) | 2010203..2010862 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS045_RS09785 (2011030) | 2011030..2011341 | - | 312 | WP_001182937.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS045_RS09790 (2011386) | 2011386..2012819 | + | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271523 WP_000244763.1 NZ_CP117583:c2008284-2007880 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |