Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 583428..584032 | Replicon | chromosome |
Accession | NZ_CP117583 | ||
Organism | Escherichia albertii strain BIA_41 |
Toxin (Protein)
Gene name | doc | Uniprot ID | B1EM00 |
Locus tag | PS045_RS02770 | Protein ID | WP_000638401.1 |
Coordinates | 583428..583814 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | B1ELZ9 |
Locus tag | PS045_RS02775 | Protein ID | WP_001195490.1 |
Coordinates | 583811..584032 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS045_RS02770 (583428) | 583428..583814 | - | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PS045_RS02775 (583811) | 583811..584032 | - | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PS045_RS02780 (584450) | 584450..584779 | + | 330 | Protein_548 | methyltransferase domain-containing protein | - |
PS045_RS02785 (584862) | 584862..585422 | - | 561 | WP_021573890.1 | recombinase family protein | - |
PS045_RS02790 (585642) | 585642..588602 | + | 2961 | WP_273774644.1 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T271515 WP_000638401.1 NZ_CP117583:c583814-583428 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T5VDW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6PD20 |