Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 31901..32544 | Replicon | plasmid pEA47_1 |
| Accession | NZ_CP117581 | ||
| Organism | Escherichia albertii strain BIA_47 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | PS044_RS22460 | Protein ID | WP_256876211.1 |
| Coordinates | 31901..32317 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | PS044_RS22465 | Protein ID | WP_256876210.1 |
| Coordinates | 32314..32544 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS044_RS22440 (PS044_22440) | 27876..28253 | + | 378 | WP_273808774.1 | hypothetical protein | - |
| PS044_RS22450 (PS044_22450) | 29416..30573 | + | 1158 | WP_256880773.1 | AAA family ATPase | - |
| PS044_RS22455 (PS044_22455) | 30781..31761 | - | 981 | WP_256876212.1 | hypothetical protein | - |
| PS044_RS22460 (PS044_22460) | 31901..32317 | - | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PS044_RS22465 (PS044_22465) | 32314..32544 | - | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PS044_RS22470 (PS044_22470) | 33114..33464 | + | 351 | WP_256880772.1 | hypothetical protein | - |
| PS044_RS22475 (PS044_22475) | 33504..34214 | + | 711 | WP_256880771.1 | hypothetical protein | - |
| PS044_RS22480 (PS044_22480) | 34227..35009 | + | 783 | WP_256880770.1 | site-specific integrase | - |
| PS044_RS22485 (PS044_22485) | 35148..35423 | - | 276 | WP_256880769.1 | CopG family transcriptional regulator | - |
| PS044_RS22490 (PS044_22490) | 35417..36061 | - | 645 | WP_256880768.1 | AAA family ATPase | - |
| PS044_RS22495 (PS044_22495) | 36290..37261 | + | 972 | WP_256880767.1 | plasmid segregation protein ParM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | espL2 | 1..40979 | 40979 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T271513 WP_256876211.1 NZ_CP117581:c32317-31901 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|