Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 4230079..4231123 | Replicon | chromosome |
Accession | NZ_CP117580 | ||
Organism | Escherichia albertii strain BIA_47 |
Toxin (Protein)
Gene name | panT | Uniprot ID | A0A8I0CFN6 |
Locus tag | PS044_RS20595 | Protein ID | WP_059274466.1 |
Coordinates | 4230079..4230627 (-) | Length | 183 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A839B6W4 |
Locus tag | PS044_RS20600 | Protein ID | WP_000287252.1 |
Coordinates | 4230650..4231123 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS044_RS20540 (4225113) | 4225113..4225253 | - | 141 | Protein_4015 | replication protein P | - |
PS044_RS20545 (4225250) | 4225250..4225468 | + | 219 | Protein_4016 | DNA recombinase | - |
PS044_RS20550 (4225452) | 4225452..4225934 | + | 483 | WP_059216138.1 | siphovirus Gp157 family protein | - |
PS044_RS20555 (4225946) | 4225946..4226260 | + | 315 | WP_059216137.1 | hypothetical protein | - |
PS044_RS20560 (4226277) | 4226277..4226441 | + | 165 | Protein_4019 | DUF2737 family protein | - |
PS044_RS20565 (4226438) | 4226438..4226998 | + | 561 | WP_059238939.1 | hypothetical protein | - |
PS044_RS20570 (4227215) | 4227215..4227874 | + | 660 | WP_059238951.1 | ead/Ea22-like family protein | - |
PS044_RS20575 (4227876) | 4227876..4228054 | + | 179 | Protein_4022 | hypothetical protein | - |
PS044_RS20580 (4228388) | 4228388..4229167 | + | 780 | WP_256876784.1 | DUF551 domain-containing protein | - |
PS044_RS20585 (4229167) | 4229167..4229739 | + | 573 | WP_001061339.1 | 3'-5' exonuclease | - |
PS044_RS20590 (4229776) | 4229776..4230045 | + | 270 | WP_001093912.1 | pyocin activator PrtN family protein | - |
PS044_RS20595 (4230079) | 4230079..4230627 | - | 549 | WP_059274466.1 | hypothetical protein | Toxin |
PS044_RS20600 (4230650) | 4230650..4231123 | - | 474 | WP_000287252.1 | DUF4065 domain-containing protein | Antitoxin |
PS044_RS20605 (4231646) | 4231646..4232161 | + | 516 | WP_002460756.1 | zinc uptake transcriptional repressor Zur | - |
PS044_RS20610 (4232202) | 4232202..4232411 | - | 210 | WP_001030604.1 | CsbD family protein | - |
PS044_RS20615 (4232527) | 4232527..4233852 | - | 1326 | WP_025237884.1 | MATE family efflux transporter DinF | - |
PS044_RS20620 (4233927) | 4233927..4234535 | - | 609 | WP_256876786.1 | transcriptional repressor LexA | - |
PS044_RS20625 (4234645) | 4234645..4235013 | - | 369 | WP_000002912.1 | diacylglycerol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4210146..4244259 | 34113 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20052.43 Da Isoelectric Point: 4.4481
>T271512 WP_059274466.1 NZ_CP117580:c4230627-4230079 [Escherichia albertii]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKPPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKPPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17298.80 Da Isoelectric Point: 8.4143
>AT271512 WP_000287252.1 NZ_CP117580:c4231123-4230650 [Escherichia albertii]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|