Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3319801..3320419 | Replicon | chromosome |
| Accession | NZ_CP117580 | ||
| Organism | Escherichia albertii strain BIA_47 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS044_RS16210 | Protein ID | WP_001280991.1 |
| Coordinates | 3320201..3320419 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS044_RS16205 | Protein ID | WP_000344798.1 |
| Coordinates | 3319801..3320175 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS044_RS16195 (3314881) | 3314881..3316074 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS044_RS16200 (3316097) | 3316097..3319246 | + | 3150 | WP_273807810.1 | efflux RND transporter permease AcrB | - |
| PS044_RS16205 (3319801) | 3319801..3320175 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS044_RS16210 (3320201) | 3320201..3320419 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS044_RS16215 (3320596) | 3320596..3321153 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| PS044_RS16220 (3321260) | 3321260..3321730 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| PS044_RS16225 (3321894) | 3321894..3323444 | + | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS044_RS16230 (3323482) | 3323482..3323835 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS044_RS16240 (3324216) | 3324216..3324527 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS044_RS16245 (3324557) | 3324557..3325129 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271506 WP_001280991.1 NZ_CP117580:3320201-3320419 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271506 WP_000344798.1 NZ_CP117580:3319801-3320175 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|