Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 693173..694008 | Replicon | chromosome |
Accession | NZ_CP117580 | ||
Organism | Escherichia albertii strain BIA_47 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | PS044_RS03400 | Protein ID | WP_001565141.1 |
Coordinates | 693631..694008 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | PS044_RS03395 | Protein ID | WP_001565140.1 |
Coordinates | 693173..693541 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS044_RS03375 (690921) | 690921..691739 | + | 819 | WP_021536653.1 | DUF932 domain-containing protein | - |
PS044_RS03380 (691831) | 691831..692316 | + | 486 | WP_001565139.1 | antirestriction protein | - |
PS044_RS03385 (692332) | 692332..692808 | + | 477 | WP_001186725.1 | RadC family protein | - |
PS044_RS03390 (692877) | 692877..693098 | + | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
PS044_RS03395 (693173) | 693173..693541 | + | 369 | WP_001565140.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PS044_RS03400 (693631) | 693631..694008 | + | 378 | WP_001565141.1 | TA system toxin CbtA family protein | Toxin |
PS044_RS03405 (694005) | 694005..694493 | + | 489 | WP_001565142.1 | DUF5983 family protein | - |
PS044_RS03410 (694505) | 694505..694702 | + | 198 | WP_000839256.1 | DUF957 domain-containing protein | - |
PS044_RS03415 (694787) | 694787..695632 | + | 846 | WP_273808229.1 | DUF4942 domain-containing protein | - |
PS044_RS03425 (695933) | 695933..696439 | + | 507 | WP_000245810.1 | G/U mismatch-specific DNA glycosylase | - |
PS044_RS03430 (696519) | 696519..698360 | - | 1842 | WP_000437385.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14246.27 Da Isoelectric Point: 7.2920
>T271496 WP_001565141.1 NZ_CP117580:693631-694008 [Escherichia albertii]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SICPRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SICPRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13604.41 Da Isoelectric Point: 6.7389
>AT271496 WP_001565140.1 NZ_CP117580:693173-693541 [Escherichia albertii]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFALLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFALLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|