Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 162841..163453 | Replicon | chromosome |
| Accession | NZ_CP117580 | ||
| Organism | Escherichia albertii strain BIA_47 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | PS044_RS00740 | Protein ID | WP_000833473.1 |
| Coordinates | 162841..163026 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | L4IWR9 |
| Locus tag | PS044_RS00745 | Protein ID | WP_000499744.1 |
| Coordinates | 163043..163453 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS044_RS00725 (158305) | 158305..159600 | + | 1296 | WP_025238096.1 | Fic family protein | - |
| PS044_RS00730 (159708) | 159708..161246 | + | 1539 | WP_010327692.1 | aldehyde dehydrogenase AldB | - |
| PS044_RS00735 (161287) | 161287..162366 | - | 1080 | WP_025238097.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| PS044_RS00740 (162841) | 162841..163026 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PS044_RS00745 (163043) | 163043..163453 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PS044_RS00750 (163525) | 163525..165489 | - | 1965 | Protein_148 | glycoside hydrolase family 127 protein | - |
| PS044_RS00755 (165500) | 165500..166900 | - | 1401 | WP_025238099.1 | MFS transporter | - |
| PS044_RS00760 (167126) | 167126..167941 | + | 816 | WP_025238100.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T271494 WP_000833473.1 NZ_CP117580:162841-163026 [Escherichia albertii]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT271494 WP_000499744.1 NZ_CP117580:163043-163453 [Escherichia albertii]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|