Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 89406..90163 | Replicon | plasmid pEA5_1 |
Accession | NZ_CP117576 | ||
Organism | Escherichia albertii strain BIA_5 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | PS037_RS23560 | Protein ID | WP_273821915.1 |
Coordinates | 89406..89891 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | PS037_RS23565 | Protein ID | WP_273821916.1 |
Coordinates | 89879..90163 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS037_RS23525 (84596) | 84596..85012 | - | 417 | WP_001278817.1 | plasmid partitioning/stability family protein | - |
PS037_RS23530 (85005) | 85005..85985 | - | 981 | WP_000688514.1 | plasmid segregation protein ParM | - |
PS037_RS23535 (86399) | 86399..86704 | - | 306 | WP_273821913.1 | molecular chaperone GroEL | - |
PS037_RS23540 (86791) | 86791..87435 | - | 645 | WP_273821914.1 | ParA family protein | - |
PS037_RS23545 (87615) | 87615..88411 | - | 797 | Protein_87 | site-specific integrase | - |
PS037_RS23550 (88412) | 88412..88715 | - | 304 | Protein_88 | type II toxin-antitoxin system toxin CcdB | - |
PS037_RS23555 (88717) | 88717..88935 | - | 219 | WP_000813638.1 | type II toxin-antitoxin system antitoxin CcdA | - |
PS037_RS23560 (89406) | 89406..89891 | - | 486 | WP_273821915.1 | GNAT family N-acetyltransferase | Toxin |
PS037_RS23565 (89879) | 89879..90163 | - | 285 | WP_273821916.1 | DUF1778 domain-containing protein | Antitoxin |
PS037_RS23570 (90915) | 90915..92126 | + | 1212 | WP_273821917.1 | YadA-like family protein | - |
PS037_RS23575 (92253) | 92253..93452 | - | 1200 | WP_273821918.1 | lipoprotein-releasing ABC transporter permease subunit LolC | - |
PS037_RS23580 (93916) | 93916..94118 | - | 203 | Protein_94 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | hsiC1/vipB / hsiB1/vipA / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..143188 | 143188 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17680.53 Da Isoelectric Point: 9.9107
>T271493 WP_273821915.1 NZ_CP117576:c89891-89406 [Escherichia albertii]
MGCVTAPEPLSSFHQAAEFVSGEVVLDDWLKQKGLKNQVLGATRTFVVCRKGTQQIVGFYSLVTGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGLTPSKTQVQTLFLKLP
Q
MGCVTAPEPLSSFHQAAEFVSGEVVLDDWLKQKGLKNQVLGATRTFVVCRKGTQQIVGFYSLVTGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGLTPSKTQVQTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|