Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 63867..64492 | Replicon | plasmid pEA5_1 |
| Accession | NZ_CP117576 | ||
| Organism | Escherichia albertii strain BIA_5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PS037_RS23400 | Protein ID | WP_273821952.1 |
| Coordinates | 64094..64492 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PS037_RS23395 | Protein ID | WP_039520356.1 |
| Coordinates | 63867..64094 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS037_RS23395 (63867) | 63867..64094 | + | 228 | WP_039520356.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PS037_RS23400 (64094) | 64094..64492 | + | 399 | WP_273821952.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PS037_RS23405 (64501) | 64501..65130 | - | 630 | Protein_59 | type IV secretion system DNA-binding domain-containing protein | - |
| PS037_RS23410 (65195) | 65195..65977 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| PS037_RS23415 (65974) | 65974..66996 | - | 1023 | WP_273821257.1 | IS21-like element IS100 family transposase | - |
| PS037_RS23420 (67053) | 67053..67304 | + | 252 | WP_273821953.1 | hypothetical protein | - |
| PS037_RS23425 (67820) | 67820..68269 | - | 450 | WP_273821954.1 | CaiF/GrlA family transcriptional regulator | - |
| PS037_RS23430 (68585) | 68585..69358 | - | 774 | WP_273821955.1 | F4 (K88) fimbria accessory protein FaeJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hsiC1/vipB / hsiB1/vipA / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..143188 | 143188 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14945.21 Da Isoelectric Point: 7.8605
>T271492 WP_273821952.1 NZ_CP117576:64094-64492 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDATAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDATAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|